Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chilled Somen with Ginger & Snap Peas

Ultra-fresh Japanese somen noodles served ice-cold with a light dipping sauce, pickled ginger, and crisp snap peas. Ready in 15 minutes—pure summer comfort.

Total time
15 min
Servings
2
Calories
245
Protein
7g
Chilled Somen with Ginger & Snap Peas
lightrefreshingjapanesevegetarianvegantendercrispyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring a pot of salted water to boil. Add somen noodles and cook until just tender, ~3 minutes.

  2. Step 2

    Drain noodles and rinse under ice-cold water until completely cool, stirring gently with chopsticks.

  3. Step 3

    Stir dashi, soy sauce, and mirin in a bowl until sugar dissolves. Divide between two small dipping bowls.

  4. Step 4

    Arrange noodles on a chilled plate or serving dish. Top with pickled ginger and snap peas.

  5. Step 5

    Serve noodles with ice cubes alongside the dipping sauce. Dip bites of noodles and vegetables into sauce.

Tools you’ll need

  • large pot
  • colander
  • small bowls (2)
  • serving plate
  • chopsticks or fork

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.