Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Clay Pot Chicken & Sausage Rice

Crispy-bottomed jasmine rice layered with chicken, Chinese sausage, and aromatics, finished with a savory caramelized soy glaze. Cooked entirely in one pot for maximum flavor and minimal cleanup.

Total time
28 min
Servings
2
Calories
680
Protein
42g
Clay Pot Chicken & Sausage Rice
comfortsatisfyingvietnamesechickenporkcrispytenderfluffy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Rinse rice under cold water until water runs clear, then drain. Add 2.25 cups water to a clay pot or heavy skillet.

  2. Step 2

    Bring water to a boil over medium-high heat, then add rice. Stir once, lower heat to medium-low, and cover tightly.

  3. Step 3

    While rice cooks, heat oil in a separate skillet over medium-high. Brown chicken pieces, breaking up clumps, until edges turn golden, about 4 minutes.

  4. Step 4

    Add sausage and diced onion to the chicken. Stir for 2 minutes until sausage releases its oil and onion softens.

  5. Step 5

    Pour soy sauce over the chicken mixture and stir. After rice has cooked about 12 minutes total, scatter the chicken mixture on top without stirring.

  6. Step 6

    Re-cover the pot and cook 3 more minutes. Remove from heat, fluff rice gently with a fork, top with scallion whites and greens, and serve hot.

Tools you’ll need

  • clay pot or 12-inch heavy skillet with lid
  • 8-inch skillet
  • wooden spoon
  • fork

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.