Back to recipes
Coconut Macaroon Bites
No-bake coconut bites with just four ingredients and zero oven time. Chewy, lightly sweet, ready to eat in under 10 minutes.
- Total time
- 10 min
- Servings
- 12
- Calories
- 156
- Protein
- 1g
simpleindulgentvegetarianchewycrispysnackcookiesnack
Ingredients
4 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Stir together coconut, condensed milk, and vanilla until fully combined.
Step 2
Scoop mixture into 1-inch balls using a cookie scoop or spoon.
Step 3
Microwave chocolate chips in 30-second bursts, stirring between, until melted.
Step 4
Dip each bite halfway into melted chocolate; place on parchment to set.
Step 5
Refrigerate 5 minutes until chocolate hardens. Serve cold.
Tools you’ll need
- mixing bowl
- spoon or cookie scoop
- microwave-safe bowl
- microwave
- parchment paper
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
