Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Coconut Shrimp Vatapá

Creamy, aromatic Brazilian coconut-peanut sauce with shrimp, finished with toasted bread crumbs. One-skillet dinner that tastes like the coast.

Total time
20 min
Servings
2
Calories
520
Protein
38g
20-Min Coconut Shrimp Vatapá
comfortelegantbrazilianshrimpcreamytenderweeknightdinner

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp olive oil in a large skillet over medium-high until shimmering, about 90 seconds.

  2. Step 2

    Add shrimp, season with salt and pepper, cook 90 seconds per side until edges curl.

  3. Step 3

    Remove shrimp to a plate. Add minced garlic to the pan, cook 30 seconds until fragrant.

  4. Step 4

    Pour in coconut milk and tomatoes with their liquid, stir in peanut butter until smooth.

  5. Step 5

    Return shrimp to the pan, simmer 2 minutes to warm through, then squeeze lime juice over top.

  6. Step 6

    Toast bread pieces in a dry skillet over medium heat 2–3 minutes until golden, tossing often.

  7. Step 7

    Pour sauce into bowls, top with shrimp, toasted bread crumbs, and fresh cilantro. Serve hot.

Tools you’ll need

  • 12-inch skillet
  • wooden spoon
  • small skillet or cast iron pan
  • bowls for serving

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.