Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cold Buckwheat Noodles with Tororo Dipping Sauce

Silky tororo (grated yam) dipping sauce turns simple cold soba into a luxe weeknight dinner. Serve with pickled cucumbers and a drizzle of nutty dashi broth.

Total time
20 min
Servings
2
Calories
320
Protein
12g
Cold Buckwheat Noodles with Tororo Dipping Sauce
freshlightsimplejapanesevegetariandairy-freevegetariansilky

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring a pot of salted water to a boil. Add soba and cook until al dente, stirring gently, ~3 minutes.

  2. Step 2

    Drain soba and rinse under cold running water until completely cool. Shake dry and divide between two bowls.

  3. Step 3

    Whisk dashi, soy sauce, and mirin in a small bowl until combined. Pour into two small dipping cups.

  4. Step 4

    Stir grated yam into each dipping cup until smooth and frothy — this is the tororo sauce.

  5. Step 5

    Top each noodle bowl with pickled cucumbers and nori strips. Serve with tororo dipping sauce on the side.

Tools you’ll need

  • large pot
  • colander
  • small mixing bowl
  • whisk
  • two small dipping cups or bowls
  • fine grater (microplane or box grater)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.