Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Com Ga Xoi Mo (Vietnamese Chicken Rice)

Silky chicken poached in aromatics, shredded and served over fragrant rice with a ginger-scallion oil. A Vietnamese comfort classic that's light yet deeply satisfying.

Total time
45 min
Servings
4
Calories
595
Protein
42g
Com Ga Xoi Mo (Vietnamese Chicken Rice)
comfortwholesomevietnamesechickentendersilkyweeknightcomfort-food-night

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring 8 cups water to a boil in a large pot. Add chicken, half the ginger (smashed), 3 scallions (whole), and 1 tbsp fish sauce.

  2. Step 2

    Reduce heat and simmer 12–15 minutes until chicken is cooked through. Remove chicken and set aside; strain broth into a measuring cup.

  3. Step 3

    Measure 4 cups broth back into the pot. Bring to a boil and stir in rice. Reduce heat, cover, and cook 18 minutes until tender.

  4. Step 4

    Shred the cooled chicken into bite-sized pieces with two forks.

  5. Step 5

    Mince remaining ginger and remaining 3 scallions. Heat oil in a small skillet over medium until shimmering, ~2 minutes.

  6. Step 6

    Add ginger and scallions; cook 1 minute until fragrant. Remove from heat and stir in remaining 2 tbsp fish sauce.

  7. Step 7

    Fluff rice with a fork. Divide rice among bowls and top with shredded chicken.

  8. Step 8

    Drizzle ginger-scallion oil over each bowl. Season with salt and pepper to taste. Serve immediately.

Tools you’ll need

  • large pot with lid (6+ quart)
  • small skillet
  • measuring cups and spoons
  • two forks (for shredding)
  • spoon or ladle

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.