Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Creamy Herbed Cheese Pasta

Boursin-style herbed cream cheese melts into hot pasta with cherry tomatoes for a silky, garlicky dinner that comes together in under 15 minutes. No cream needed—just the cheese, pasta water, and heat.

Total time
12 min
Servings
2
Calories
520
Protein
16g
Creamy Herbed Cheese Pasta
comfortsimplefrenchvegetariancreamytenderweeknightpasta

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil pasta in salted water until al dente, about 9 minutes.

  2. Step 2

    Reserve 1 cup pasta water, then drain the pasta.

  3. Step 3

    Heat 1 tbsp oil in the same pot over medium, then add garlic and cook until fragrant, 30 seconds.

  4. Step 4

    Add cherry tomatoes, then cook until edges start to soften, about 2 minutes.

  5. Step 5

    Return pasta to pot, add herbed cream cheese, then stir with 0.5 cup pasta water until silky and creamy.

  6. Step 6

    Serve hot, adding more pasta water if needed to loosen.

Tools you’ll need

  • large pot for boiling pasta
  • wooden spoon for stirring

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.