Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Creamy Mushroom Mafaldine

Tender mafaldine ribbons tossed with silky mushroom cream and fresh thyme—restaurant-quality in 25 minutes. Garlic, butter, and a splash of white wine build deep umami without meat.

Total time
25 min
Servings
2
Calories
728
Protein
24g
Creamy Mushroom Mafaldine
comfortelegantitalianvegetarianvegetariancreamytenderweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil mafaldine in salted water until al dente, about 11 minutes. Reserve 1 cup pasta water before draining.

  2. Step 2

    While pasta cooks, heat 2 tbsp butter in a large skillet over medium-high until foaming.

  3. Step 3

    Add mushroom slices; sauté until golden and liquid releases, about 5 minutes. Season with salt and pepper.

  4. Step 4

    Stir in shallots and garlic, cooking until fragrant, about 1 minute. Pour wine to deglaze; simmer 2 minutes.

  5. Step 5

    Add cream and thyme sprigs, simmer 2 minutes until sauce thickens slightly. Stir in parmesan until melted.

  6. Step 6

    Add cooked pasta to the skillet; toss gently, adding pasta water if needed for a silky finish. Serve hot.

Tools you’ll need

  • large pot (for pasta)
  • large skillet or sauté pan (12-inch)
  • wooden spoon
  • measuring cups and spoons
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.