Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Creamy Mustard Chicken with Crispy Fries

Pan-seared chicken thighs in a silky Dijon mustard cream sauce, served alongside crispy fries and a bright side salad. Classic French bistro dinner in under 30 minutes.

Total time
28 min
Servings
2
Calories
640
Protein
42g
Creamy Mustard Chicken with Crispy Fries
comfortelegantfrenchchickencrispytendercreamyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Start the fries in the oven or air fryer per package directions so they'll be ready when the chicken finishes.

  2. Step 2

    Pat the chicken dry and season with salt and pepper on both sides.

  3. Step 3

    Heat oil in a large skillet over medium-high until it shimmers. Sear chicken skin-side down without moving for 6 minutes until golden.

  4. Step 4

    Flip chicken and sear the other side for 4 minutes. Transfer to a plate.

  5. Step 5

    Add shallot to the same skillet and cook for 1 minute until fragrant, then pour in white wine and scrape up browned bits.

  6. Step 6

    Whisk in mustard and cream, add thyme, and return chicken to the skillet. Simmer gently for 8 minutes until chicken is cooked through.

  7. Step 7

    Serve chicken and sauce with crispy fries and a crisp green salad on the side.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon or spatula
  • whisk
  • plate
  • oven or air fryer

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.