Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Creamy Pumpkin Soup with Crispy Shrimp

Silky roasted pumpkin soup finished with a swirl of crème fraîche and topped with pan-seared shrimp—French bistro comfort in 25 minutes. The shrimp adds protein and a touch of elegance without fussing with broth.

Total time
25 min
Servings
4
Calories
287
Protein
28g
Creamy Pumpkin Soup with Crispy Shrimp
comfortelegantfrenchshrimpcreamycrispytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp butter in a large pot over medium, then add shallot and cook until soft and fragrant, ~2 minutes.

  2. Step 2

    Pour in broth and pumpkin puree, stir, add thyme and nutmeg, then simmer gently for 8 minutes to let flavors meld.

  3. Step 3

    While soup simmers, pat shrimp dry and season with salt and pepper.

  4. Step 4

    Sear shrimp in 1 tbsp foaming butter over medium-high heat, 90 sec per side without moving, until pink and opaque.

  5. Step 5

    Stir crème fraîche into soup until smooth, then taste and adjust seasoning with salt and pepper.

  6. Step 6

    Ladle soup into bowls, top with 3–4 shrimp per serving, add a small swirl of extra crème fraîche, and serve hot.

Tools you’ll need

  • large pot
  • medium skillet
  • wooden spoon
  • ladle
  • microplane (for nutmeg)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.