CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Creamy Pumpkin Soup with Crispy Shrimp

Silky roasted pumpkin soup finished with a swirl of crème fraîche and topped with pan-seared shrimp—French bistro comfort in 25 minutes. The shrimp adds protein and a touch of elegance without fussing with broth.

Total time
25 min
Servings
4
Calories
287
Protein
28g
Creamy Pumpkin Soup with Crispy Shrimp
comfortelegantfrenchshrimpcreamycrispytenderweeknight

Ingredients

  • 2 cups pumpkin puree (or fresh roasted pumpkin)
  • 1 lb shrimp, peeled and deveined
  • 2 cups vegetable or chicken broth
  • ½ cup crème fraîche or sour cream
  • 1 medium shallot, minced
  • 1 tsp thyme (fresh or dried)
  • ¼ tsp nutmeg, freshly grated

Instructions

  1. 1

    Heat 1 tbsp butter in a large pot over medium, then add shallot and cook until soft and fragrant, ~2 minutes.

  2. 2

    Pour in broth and pumpkin puree, stir, add thyme and nutmeg, then simmer gently for 8 minutes to let flavors meld.

  3. 3

    While soup simmers, pat shrimp dry and season with salt and pepper.

  4. 4

    Sear shrimp in 1 tbsp foaming butter over medium-high heat, 90 sec per side without moving, until pink and opaque.

  5. 5

    Stir crème fraîche into soup until smooth, then taste and adjust seasoning with salt and pepper.

  6. 6

    Ladle soup into bowls, top with 3–4 shrimp per serving, add a small swirl of extra crème fraîche, and serve hot.

Tools you’ll need

  • large pot
  • medium skillet
  • wooden spoon
  • ladle
  • microplane (for nutmeg)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.