Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Air Fryer Mozzarella Sticks

Golden, melty mozzarella sticks with a crispy panko crust in 10 minutes, zero fuss. Dip in marinara and watch them disappear.

Total time
10 min
Servings
2
Calories
280
Protein
16g
Crispy Air Fryer Mozzarella Sticks
casualsatisfyingitalianvegetariancheesecrispymeltysnack

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Coat the basket of your air fryer with cooking spray.

  2. Step 2

    Toss frozen mozzarella sticks with panko until evenly coated.

  3. Step 3

    Arrange sticks in the basket in a single layer, spray lightly with cooking spray.

  4. Step 4

    Air fry at 380°F for 8 minutes until golden and crispy outside.

  5. Step 5

    Warm marinara in a small bowl or saucepan, about 1 minute.

  6. Step 6

    Serve sticks immediately with warm marinara for dipping.

Tools you’ll need

  • air fryer
  • small bowl
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.