Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Amritsari Fish Fry

Golden, spiced fish fritters with a crackly exterior and tender interior—Amritsar's iconic street snack done in 25 minutes. Tangy tamarind sauce and fresh cilantro finish the bite.

Total time
25 min
Servings
2
Calories
420
Protein
28g
Crispy Amritsari Fish Fry
casualindulgentindianfishcrispytenderflakyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat fish dry with paper towels. Toss with 0.5 tsp salt, ginger-garlic paste, and minced green chili.

  2. Step 2

    Mix cornstarch, flour, 0.5 tsp salt, and 0.5 tsp black pepper in a bowl. Add 3 tbsp water to form a batter.

  3. Step 3

    Heat neutral oil in a large skillet over medium-high until it shimmers and a drop of batter sizzles immediately.

  4. Step 4

    Coat fish pieces in batter, then carefully slide into hot oil in batches (don't crowd). Fry 2–2.5 minutes per side until golden and crispy.

  5. Step 5

    Transfer fried fish to a paper towel–lined plate. Sprinkle with salt while still hot.

  6. Step 6

    Stir tamarind paste with 1 tbsp water. Drizzle over fish, top with cilantro, and serve immediately.

Tools you’ll need

  • Large heavy-bottomed skillet (12-inch)
  • Mixing bowl
  • Paper towels
  • Slotted spoon or spider skimmer
  • Instant-read thermometer (optional, for oil temp ~350°F)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.