Crispy Baked Buffalo Wings
Chicken wings tossed in buffalo sauce and baked until crispy, ready in under 25 minutes. Serve with ranch or blue cheese dip and fresh greens for a complete weeknight dinner.
- Total time
- 25 min
- Servings
- 4
- Calories
- 420
- Protein
- 38g

satisfyingcasualamericanchickencrispytenderweeknightgame-day
Ingredients
- 2 lbs chicken wings (drummettes and flats)
- ¾ cup buffalo sauce
- 2 tbsp butter
Instructions
- 1
Preheat oven to 425°F and line a sheet pan with foil.
- 2
Pat wings dry with paper towels, then toss with salt and pepper on the sheet pan.
- 3
Spread wings in a single layer and bake 20 minutes until edges start to crisp.
- 4
Warm buffalo sauce and butter together in a small bowl until butter melts.
- 5
Remove wings from oven, toss with buffalo-butter mixture until coated, then serve hot.
Tools you’ll need
- sheet pan
- aluminum foil
- paper towels
- small bowl
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



