Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Baked Buffalo Wings

Chicken wings tossed in buffalo sauce and baked until crispy, ready in under 25 minutes. Serve with ranch or blue cheese dip and fresh greens for a complete weeknight dinner.

Total time
25 min
Servings
4
Calories
420
Protein
38g
Crispy Baked Buffalo Wings
satisfyingcasualamericanchickencrispytenderweeknightgame-day

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F and line a sheet pan with foil.

  2. Step 2

    Pat wings dry with paper towels, then toss with salt and pepper on the sheet pan.

  3. Step 3

    Spread wings in a single layer and bake 20 minutes until edges start to crisp.

  4. Step 4

    Warm buffalo sauce and butter together in a small bowl until butter melts.

  5. Step 5

    Remove wings from oven, toss with buffalo-butter mixture until coated, then serve hot.

Tools you’ll need

  • sheet pan
  • aluminum foil
  • paper towels
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.