Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Beef Agujas Norteñas

Thin, crispy fried beef strips tossed with a bright lime-chile glaze and served with warm tortillas. A quick, restaurant-quality dish that tastes way harder than it actually is.

Total time
25 min
Servings
4
Calories
520
Protein
38g
Crispy Beef Agujas Norteñas
satisfyingcasualmexicanbeefcrispytenderweeknightdate-night

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Toast dried chiles and garlic in a dry skillet over medium heat until fragrant, 2 minutes. Transfer to a blender with juice of 1 lime, 1/4 cup water, 1 tsp salt.

  2. Step 2

    Blend until smooth. Strain through a fine sieve into a bowl, pressing to extract liquid. Set aside.

  3. Step 3

    Pat beef dry with paper towels. Season generously with salt and pepper on both sides.

  4. Step 4

    Heat oil in a heavy pot or deep skillet to 350°F over medium-high heat. Working in batches, fry beef strips 1-2 minutes per side until golden and crispy.

  5. Step 5

    Drain fried beef on paper towels. Toss with chile glaze in a clean bowl.

  6. Step 6

    Serve immediately with warm tortillas, cilantro, and lime wedges on the side.

Tools you’ll need

  • dry skillet
  • blender
  • fine sieve
  • heavy pot or deep skillet
  • instant-read thermometer
  • paper towels
  • slotted spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.