Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Beef Croquettes (15-Min Kroketten)

Dutch-style beef croquettes with a golden panko crust and creamy beef interior, ready in 10 minutes using pre-cooked rotisserie beef or leftover roast. Serve with mustard for dipping.

Total time
15 min
Servings
2
Calories
385
Protein
22g
Crispy Beef Croquettes (15-Min Kroketten)
comfortcasualdutchbeefcrispycreamyweeknightdinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Melt butter in a small saucepan over medium heat. Add flour, stir constantly for 1 minute until light golden.

  2. Step 2

    Whisk in milk slowly until no lumps remain. Add shredded beef, salt, and pepper. Stir until thick paste forms, ~2 minutes.

  3. Step 3

    Spread beef mixture on a plate and refrigerate while you prepare to fry, about 3 minutes.

  4. Step 4

    Shape mixture into 4 logs (about 3 inches long). Roll each in panko until fully coated.

  5. Step 5

    Heat oil in a large skillet over medium-high until shimmering. Fry croquettes 90 seconds per side until deep golden brown.

  6. Step 6

    Serve hot with dijon mustard for dipping.

Tools you’ll need

  • small saucepan
  • whisk
  • plate
  • large skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.