Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Beef Milanesa

Thin-pounded beef cutlets breaded and pan-fried until golden and crackling. Serve with lemon, fresh salad, or chimichurri for an instant weeknight dinner that tastes like a Buenos Aires kitchen.

Total time
20 min
Servings
2
Calories
520
Protein
38g
Crispy Beef Milanesa
casualsatisfyingargentinianbeefcrispytenderweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    If not pre-pounded, lay beef between plastic wrap and pound to 1/8-inch thick using a meat mallet.

  2. Step 2

    Pat dry with paper towels. Season both sides generously with salt and black pepper.

  3. Step 3

    Set up three shallow bowls: flour, beaten egg, and panko. Dredge each cutlet in flour, tap off excess, dip in egg, then coat evenly with panko.

  4. Step 4

    Heat oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  5. Step 5

    Fry breaded cutlets 2–3 minutes per side without moving until golden brown and crisp. Work in batches if needed.

  6. Step 6

    Transfer to a plate. Squeeze fresh lemon over the top and serve hot.

Tools you’ll need

  • meat mallet
  • paper towels
  • three shallow bowls
  • 12-inch skillet
  • tongs or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.