Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Boondi Ladoo

Golden, crunchy gram flour pearls rolled in cardamom-spiked sugar syrup and finished with toasted nuts. A 20-minute Indian sweet that's crispy outside, chewy within.

Total time
20 min
Servings
4
Calories
380
Protein
6g
Crispy Boondi Ladoo
indulgentcelebratoryindianvegetarianegg-freedairy-freecrispychewy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a heavy skillet over medium-high until a drop of batter sizzles on contact, about 90 seconds.

  2. Step 2

    Pour gram flour into a squeeze bottle. Drizzle thin streams into hot oil, creating pea-sized pearls; fry 2 minutes until light golden.

  3. Step 3

    Drain boondi on a paper-towel-lined plate, letting excess oil drip off.

  4. Step 4

    In a small saucepan, combine sugar, water, and crushed cardamom. Bring to a boil, stirring, then simmer 3 minutes until syrup thickens slightly.

  5. Step 5

    Pour warm syrup over cooled boondi, stirring gently to coat every pearl without crushing them.

  6. Step 6

    Fold in cashews and raisins. Let rest 2 minutes for ladoos to set, then serve at room temperature or chilled.

Tools you’ll need

  • heavy-bottomed skillet (12-inch)
  • squeeze bottle or piping bag
  • paper towels
  • small saucepan
  • wooden spoon
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.