Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Crispy Bun Xao

Crispy chow mein noodles tossed with shrimp, chicken, and a tangy-sweet Vietnamese sauce. High heat, one skillet, ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
420
Protein
32g
20-Min Crispy Bun Xao
quicksatisfyingvietnameseshrimpchickencrispytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk fish sauce, lime juice, sugar, and 2 tbsp water in a small bowl until sugar dissolves. Set aside.

  2. Step 2

    Heat 2 tbsp oil in a 12-inch skillet over medium-high until it shimmers, about 90 seconds.

  3. Step 3

    Add shrimp and cook without stirring for 90 seconds, then flip and cook 60 seconds more until opaque throughout.

  4. Step 4

    Add chicken and crispy noodles, tossing constantly for 1 minute until heated through.

  5. Step 5

    Pour sauce over the pan and toss everything together for 30 seconds until glossy and combined.

  6. Step 6

    Remove from heat, scatter scallions on top, and serve immediately.

Tools you’ll need

  • 12-inch skillet
  • small mixing bowl
  • whisk
  • tongs or wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.