CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Cheese Pasta with Caramelized Onions

Älplermagronen reimagined as a one-pan cheesy pasta with sweet caramelized onions and crispy fried shallots. Comfort food that feels fancy, ready in 18 minutes.

Total time
18 min
Servings
4
Calories
618
Protein
18g
Crispy Cheese Pasta with Caramelized Onions
comfortcozyswissvegetariancheesecrispycreamytender

Ingredients

  • 12 oz elbow pasta
  • 2 large yellow onions
  • 1.5 cups gruyère or emmental cheese, shredded
  • ½ cup heavy cream
  • ½ cup crispy fried onions or shallots
  • 2 tbsp fresh thyme or chives

Instructions

  1. 1

    Slice onions into thin half-moons. Heat 2 tbsp butter in a large skillet over medium-low, add onions with a pinch of salt.

  2. 2

    Cook onions, stirring occasionally, until deep golden and jammy, about 12 minutes. Transfer to a plate.

  3. 3

    Boil pasta in salted water until al dente. Reserve 0.75 cup pasta water before draining.

  4. 4

    Return skillet to medium heat. Add drained pasta, cream, and cheese. Toss gently, adding pasta water 2 tbsp at a time until sauce coats the noodles.

  5. 5

    Fold caramelized onions back into pasta. Season with salt and pepper to taste.

  6. 6

    Divide into bowls. Top with crispy fried onions and fresh herbs. Serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • pot for boiling pasta
  • wooden spoon
  • colander
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.