Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Cheese Pasta with Caramelized Onions

Älplermagronen reimagined as a one-pan cheesy pasta with sweet caramelized onions and crispy fried shallots. Comfort food that feels fancy, ready in 18 minutes.

Total time
18 min
Servings
4
Calories
618
Protein
18g
Crispy Cheese Pasta with Caramelized Onions
comfortcozyswissvegetariancheesecrispycreamytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice onions into thin half-moons. Heat 2 tbsp butter in a large skillet over medium-low, add onions with a pinch of salt.

  2. Step 2

    Cook onions, stirring occasionally, until deep golden and jammy, about 12 minutes. Transfer to a plate.

  3. Step 3

    Boil pasta in salted water until al dente. Reserve 0.75 cup pasta water before draining.

  4. Step 4

    Return skillet to medium heat. Add drained pasta, cream, and cheese. Toss gently, adding pasta water 2 tbsp at a time until sauce coats the noodles.

  5. Step 5

    Fold caramelized onions back into pasta. Season with salt and pepper to taste.

  6. Step 6

    Divide into bowls. Top with crispy fried onions and fresh herbs. Serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • pot for boiling pasta
  • wooden spoon
  • colander
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.