Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Crispy Chicken Bastilla

Phyllo-wrapped chicken with warm spices, honey, and a dusting of powdered sugar — the sweet-savory magic of Morocco in a weeknight pan. Crispy, fragrant, and ready in 20 minutes.

Total time
20 min
Servings
2
Calories
468
Protein
32g
20-Min Crispy Chicken Bastilla
elegantcozymoroccanchickencrispytenderflakyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a medium skillet over medium-high. Add diced onion, cook until soft, ~3 minutes.

  2. Step 2

    Stir in shredded chicken, honey, and spice blend. Cook until fragrant and warmed through, ~2 minutes.

  3. Step 3

    Lay one phyllo sheet flat. Brush lightly with oil. Layer a second sheet on top, brush again.

  4. Step 4

    Spread half the chicken mixture down the center. Fold sides in, then roll tightly like a burrito.

  5. Step 5

    Repeat with remaining phyllo sheets and chicken. Pan-fry both rolls seam-side down until golden, ~2 min per side.

  6. Step 6

    Transfer to a plate. Dust generously with powdered sugar and serve hot.

Tools you’ll need

  • medium skillet (10-inch)
  • wooden spoon or spatula
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.