Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Crispy Chicken Ouzi

Shredded rotisserie chicken wrapped in crispy phyllo with warm spices and a hint of lemon. Baked until golden, it's the TikTok-easy version of Syria's beloved pastry.

Total time
18 min
Servings
2
Calories
485
Protein
34g
20-Min Crispy Chicken Ouzi
comfortelegantsyrianmiddle-easternchickencrispytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Mix shredded chicken with lemon zest, lemon juice, cinnamon, salt, and pepper until fragrant.

  2. Step 2

    Brush one phyllo sheet with melted butter. Layer 2 more sheets on top, brushing each with butter.

  3. Step 3

    Spoon half the chicken mixture and half the pine nuts along one long edge, leaving a 2-inch border.

  4. Step 4

    Roll tightly from the filling side, tucking in the sides as you go. Brush the outside generously with butter.

  5. Step 5

    Repeat steps 2–4 with remaining phyllo, chicken, and pine nuts. Place both rolls seam-side down on a sheet pan.

  6. Step 6

    Bake for 10–12 minutes until deep golden brown and edges curl slightly. Slice and serve hot.

Tools you’ll need

  • sheet pan
  • small bowl
  • pastry brush
  • oven (400°F)
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.