Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Chicken Satay

Juicy chicken thighs roasted until edges crisp, paired with a silky peanut sauce spiked with lime and garlic. One sheet pan, zero fuss.

Total time
18 min
Servings
4
Calories
420
Protein
38g
Crispy Chicken Satay
satisfyingcasualthaichickencrispytendercreamyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken dry. Toss with 1 tbsp oil, salt, and pepper. Spread on a sheet pan in a single layer.

  2. Step 2

    Roast at 425°F until edges brown and a thermometer reads 165°F at the thickest point, 12–14 minutes.

  3. Step 3

    While chicken cooks, whisk peanut butter, soy sauce, lime juice and zest, garlic, and sriracha in a small bowl until smooth.

  4. Step 4

    If sauce is thick, thin it with 2–3 tbsp water until it reaches a drizzle consistency.

  5. Step 5

    Drizzle sauce over hot chicken. Serve immediately with lime wedges and cilantro if you have it.

Tools you’ll need

  • sheet pan
  • measuring cups and spoons
  • paper towels
  • small bowl and whisk
  • meat thermometer
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.