CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Com Tay Cam (Golden Mixed Rice)

Shrimp, crab, and egg scrambled into crispy fried rice, finished with a squeeze of lime and fresh herbs. A Vietnamese weeknight classic that tastes restaurant-quality but takes 20 minutes flat.

Total time
20 min
Servings
2
Calories
485
Protein
32g
Crispy Com Tay Cam (Golden Mixed Rice)
casualsatisfyingvietnameseshrimpcrabcrispytenderweeknight

Ingredients

  • 3 cups cooked white rice, day-old and chilled
  • ½ lb shrimp, peeled and deveined
  • ⅓ cup lump crab meat
  • 3 whole eggs
  • 1.5 tbsp fish sauce
  • 1 whole lime (juiced)
  • ⅓ cup fresh cilantro and scallions, chopped

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over medium-high until shimmering, ~90 seconds.

  2. 2

    Add shrimp and cook until pink and cooked through, ~3 minutes. Transfer to a plate.

  3. 3

    Pour beaten eggs into the same skillet. Scramble until fluffy, ~2 minutes, then push to the side.

  4. 4

    Add chilled rice to the open space, breaking up clumps. Stir-fry 4 minutes until edges turn golden and crispy.

  5. 5

    Return shrimp to the pan. Add crab meat, fish sauce, and half the lime juice. Toss until warmed through, ~90 seconds.

  6. 6

    Divide into bowls. Garnish with cilantro, scallions, remaining lime juice, and a pinch of salt and pepper.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon or spatula
  • plate
  • knife and cutting board
  • bowl for beating eggs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.