Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Com Tay Cam (Golden Mixed Rice)

Shrimp, crab, and egg scrambled into crispy fried rice, finished with a squeeze of lime and fresh herbs. A Vietnamese weeknight classic that tastes restaurant-quality but takes 20 minutes flat.

Total time
20 min
Servings
2
Calories
485
Protein
32g
Crispy Com Tay Cam (Golden Mixed Rice)
casualsatisfyingvietnameseshrimpcrabcrispytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a large skillet over medium-high until shimmering, ~90 seconds.

  2. Step 2

    Add shrimp and cook until pink and cooked through, ~3 minutes. Transfer to a plate.

  3. Step 3

    Pour beaten eggs into the same skillet. Scramble until fluffy, ~2 minutes, then push to the side.

  4. Step 4

    Add chilled rice to the open space, breaking up clumps. Stir-fry 4 minutes until edges turn golden and crispy.

  5. Step 5

    Return shrimp to the pan. Add crab meat, fish sauce, and half the lime juice. Toss until warmed through, ~90 seconds.

  6. Step 6

    Divide into bowls. Garnish with cilantro, scallions, remaining lime juice, and a pinch of salt and pepper.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon or spatula
  • plate
  • knife and cutting board
  • bowl for beating eggs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.