Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

10-Min Crispy Dolmades with Lemon

Jarred dolmades crisped in a skillet until edges curl, finished with a bright lemon-butter drizzle. Ready in under 10 minutes—no stuffing required.

Total time
10 min
Servings
2
Calories
285
Protein
7g
10-Min Crispy Dolmades with Lemon
freshsimplegreekmediterraneanvegetarianvegetariancrispytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Drain dolmames and pat dry with paper towels.

  2. Step 2

    Heat butter in a skillet over medium-high heat until foaming, about 60 seconds.

  3. Step 3

    Add dolmames and cook without stirring until edges brown and crisp, 3-4 minutes.

  4. Step 4

    Add minced garlic and cook 30 seconds until fragrant, then squeeze in lemon juice.

  5. Step 5

    Toss to coat. Season with salt, pepper, and fresh dill.

  6. Step 6

    Serve hot, drizzling any pan sauce over the top.

Tools you’ll need

  • 12-inch skillet or sauté pan
  • paper towels
  • colander or strainer
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.