CookSnap is in beta — Get it free on TestFlight →
Back to recipes

10-Min Crispy Dolmades with Lemon

Jarred dolmades crisped in a skillet until edges curl, finished with a bright lemon-butter drizzle. Ready in under 10 minutes—no stuffing required.

Total time
10 min
Servings
2
Calories
285
Protein
7g
10-Min Crispy Dolmades with Lemon
freshsimplegreekmediterraneanvegetarianvegetariancrispytender

Ingredients

  • 1 jar (about 16 oz) jarred dolmades (grape leaves stuffed with rice)
  • 2 tbsp butter
  • 1 whole (juiced) lemon
  • 1 whole garlic clove, minced
  • 1 tbsp fresh dill or oregano, chopped
  • ¼ tsp each salt and pepper

Instructions

  1. 1

    Drain dolmames and pat dry with paper towels.

  2. 2

    Heat butter in a skillet over medium-high heat until foaming, about 60 seconds.

  3. 3

    Add dolmames and cook without stirring until edges brown and crisp, 3-4 minutes.

  4. 4

    Add minced garlic and cook 30 seconds until fragrant, then squeeze in lemon juice.

  5. 5

    Toss to coat. Season with salt, pepper, and fresh dill.

  6. 6

    Serve hot, drizzling any pan sauce over the top.

Tools you’ll need

  • 12-inch skillet or sauté pan
  • paper towels
  • colander or strainer
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.