Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Feta Stuffed Tomatoes

Hollowed tomatoes stuffed with herby breadcrumbs, olives, and feta, then roasted until golden. A Mediterranean dinner that feels fancy but takes 20 minutes.

Total time
20 min
Servings
2
Calories
285
Protein
9g
Crispy Feta Stuffed Tomatoes
elegantlightmediterraneanvegetariancheesecrispytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oven to 400°F. Slice the top off each tomato and scoop out seeds and pulp with a spoon, leaving a 1/4-inch shell.

  2. Step 2

    Mix feta, panko, olives, parsley, and lemon zest in a bowl until evenly combined.

  3. Step 3

    Drizzle 1 tbsp olive oil onto a sheet pan. Place hollowed tomatoes cut-side up on the pan.

  4. Step 4

    Spoon the feta mixture into each tomato, packing gently. Drizzle the remaining 2 tbsp oil over the tops.

  5. Step 5

    Roast until tomato skin splits slightly and filling is golden brown, 12 to 15 minutes.

  6. Step 6

    Cool 2 minutes, then serve with a squeeze of fresh lemon juice.

Tools you’ll need

  • sheet pan
  • sharp chef's knife
  • spoon
  • small mixing bowl
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.