Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Fried Catfish with Hot Honey

Golden, crunchy catfish fillets fried until the edges curl, finished with a drizzle of spicy hot honey. Serve with creamy slaw or corn bread for the full Southern plate.

Total time
20 min
Servings
2
Calories
520
Protein
36g
Crispy Fried Catfish with Hot Honey
comfortsatisfyingsoutherncatfishcrispytenderweeknightcomfort-food-night

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour, cornmeal, cajun seasoning, salt, and pepper in a shallow bowl.

  2. Step 2

    Pat catfish dry with paper towels, then dredge both sides in the flour mixture.

  3. Step 3

    Heat 0.5 inch neutral oil in a 12-inch skillet over medium-high until a pinch of flour sizzles instantly.

  4. Step 4

    Fry catfish 3-4 minutes per side without moving until golden brown and edges curl. Drain on paper towels.

  5. Step 5

    Whisk honey and hot sauce in a small bowl until combined.

  6. Step 6

    Drizzle hot honey over fried catfish. Serve immediately.

Tools you’ll need

  • shallow bowl
  • paper towels
  • 12-inch skillet or cast iron
  • instant-read thermometer (optional)
  • small bowl
  • slotted spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.