Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Fried Fish with Green Herb Sauce

Whole fish fried until shatteringly crisp, served with a bright cilantro-lime dipping sauce and a crunchy salt-pepper mix. Vietnamese street food that tastes like a restaurant—30 minutes, one skillet.

Total time
25 min
Servings
2
Calories
520
Protein
28g
Crispy Fried Fish with Green Herb Sauce
casualindulgentvietnamesefishcrispytenderflakyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Blend cilantro, lime juice, chopped chili, 3 tbsp water, and a pinch of salt until smooth. Pour into a serving bowl.

  2. Step 2

    Mix white pepper with 1 tbsp salt in a small bowl. Set aside as a dipping mix.

  3. Step 3

    Pat fish completely dry with paper towels. Season inside and out with salt and pepper.

  4. Step 4

    Heat oil in a large skillet over medium-high until a pinch of flour sizzles immediately (350°F).

  5. Step 5

    Coat fish lightly in flour, shaking off excess. Carefully slide into hot oil and fry 4–5 minutes per side until skin is golden and crackling—don't move it.

  6. Step 6

    Lift fish onto a paper-towel-lined plate. Serve immediately with green sauce and salt-pepper mix on the side.

Tools you’ll need

  • large skillet (12-inch)
  • instant-read thermometer or wooden toothpick
  • blender or food processor
  • paper towels
  • slotted spatula or fish turner

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.