CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Fried Fish with Green Herb Sauce

Whole fish fried until shatteringly crisp, served with a bright cilantro-lime dipping sauce and a crunchy salt-pepper mix. Vietnamese street food that tastes like a restaurant—30 minutes, one skillet.

Total time
25 min
Servings
2
Calories
520
Protein
28g
Crispy Fried Fish with Green Herb Sauce
casualindulgentvietnamesefishcrispytenderflakyweeknight

Ingredients

  • 2 fillets or 1 whole fish (12 oz total) whole white fish (sea bass, branzino, or snapper)
  • 2 cups neutral cooking oil
  • ½ cup all-purpose flour
  • 1 cup fresh cilantro, packed
  • 2 whole (juiced) lime
  • 1 whole Thai green chili or jalapeño
  • 2 tbsp white pepper (or black pepper)

Instructions

  1. 1

    Blend cilantro, lime juice, chopped chili, 3 tbsp water, and a pinch of salt until smooth. Pour into a serving bowl.

  2. 2

    Mix white pepper with 1 tbsp salt in a small bowl. Set aside as a dipping mix.

  3. 3

    Pat fish completely dry with paper towels. Season inside and out with salt and pepper.

  4. 4

    Heat oil in a large skillet over medium-high until a pinch of flour sizzles immediately (350°F).

  5. 5

    Coat fish lightly in flour, shaking off excess. Carefully slide into hot oil and fry 4–5 minutes per side until skin is golden and crackling—don't move it.

  6. 6

    Lift fish onto a paper-towel-lined plate. Serve immediately with green sauce and salt-pepper mix on the side.

Tools you’ll need

  • large skillet (12-inch)
  • instant-read thermometer or wooden toothpick
  • blender or food processor
  • paper towels
  • slotted spatula or fish turner

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.