Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Ghee Dosa with Chili Oil

Paper-thin, golden dosa brushed with ghee and finished with chili oil and crispy onions. Ready in 15 minutes using a premade dosa batter shortcut.

Total time
15 min
Servings
2
Calories
420
Protein
6g
Crispy Ghee Dosa with Chili Oil
comfortcasualindianvegetarianvegetariancrispytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat a non-stick skillet or griddle over medium-high. Lightly brush with ghee.

  2. Step 2

    Pour 1/3 cup batter onto the hot surface. Spread with the back of a spoon in a thin circle, ~8 inches across.

  3. Step 3

    Drizzle ghee around the edges and scatter sliced onions on top. Cook until the bottom turns golden and crispy, ~2 minutes.

  4. Step 4

    Fold the dosa in half or roll it. Transfer to a plate.

  5. Step 5

    Mix sambar powder with remaining ghee and chili flakes. Drizzle over the warm dosa.

  6. Step 6

    Serve immediately with coconut chutney on the side.

Tools you’ll need

  • non-stick skillet or dosa griddle, 10-12 inches
  • spatula or dosa spreader
  • spoon
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.