Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Ghee Roast Dosa

Golden, lacy dosa crisped in ghee with roasted spices and finished with caramelized onions. A restaurant-style South Indian breakfast or dinner that tastes like it took hours but cooks in under 20 minutes.

Total time
18 min
Servings
2
Calories
380
Protein
6g
Crispy Ghee Roast Dosa
elegantsatisfyingindianvegetariangluten-freevegetariancrispycreamy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp ghee in a large skillet over medium-high until it shimmers and smells nutty, about 1 minute.

  2. Step 2

    Add sliced onion and cook, stirring often, until edges brown and char, 5–6 minutes. Scrape onto a plate.

  3. Step 3

    Pour 0.5 cup batter into the center of the skillet and spread in a thin circular motion until the crepe is lacy and edges are translucent.

  4. Step 4

    Drizzle 0.75 tbsp ghee around the edges, then scatter mustard seeds, curry leaves, and a pinch of red chili powder on top.

  5. Step 5

    Cook until the bottom is golden and crispy, 2–3 minutes, then flip carefully and cook the other side for 1 minute until light brown.

  6. Step 6

    Slide onto a plate, top with roasted onions and cilantro, then repeat with remaining batter and ghee. Serve hot.

Tools you’ll need

  • 12-inch non-stick skillet or cast iron
  • spatula or metal crepe spreader
  • slotted spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.