Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Crispy Lemon Dolmades

Tender grape leaves stuffed with herby rice and pan-fried until golden, finished with a bright lemon squeeze. A weeknight Greek dinner that tastes like you spent hours rolling by hand.

Total time
20 min
Servings
2
Calories
285
Protein
8g
20-Min Crispy Lemon Dolmades
freshlightgreekvegetarianveganvegetariantendercrispy

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Rinse grape leaves under cool water and gently separate them. Pat dry with paper towels.

  2. Step 2

    Stir cooked rice with dill, mint, lemon zest, pine nuts, salt, and pepper until well combined.

  3. Step 3

    Lay a grape leaf shiny-side down. Place 2 tbsp filling near the stem end, fold sides inward, then roll away from you into a tight cigar. Repeat with remaining leaves and filling.

  4. Step 4

    Heat olive oil in a large skillet over medium-high heat until shimmering, about 90 seconds.

  5. Step 5

    Working in batches, place dolmades seam-side down in the skillet. Don't crowd the pan. Sear 2–3 minutes per side until edges curl slightly and leaves turn olive-gold.

  6. Step 6

    Transfer dolmades to a serving plate. Squeeze fresh lemon juice over the top and finish with a light pinch of fleur de sel if you have it.

Tools you’ll need

  • paper towels
  • medium bowl
  • large 12-inch skillet
  • kitchen knife
  • microplane zester (optional)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.