Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Mak Guksu

Chewy Korean noodles tossed with crispy potato, zucchini, and a savory soy-garlic sauce. Ready in under 25 minutes and hits every textural note.

Total time
25 min
Servings
2
Calories
420
Protein
9g
Crispy Mak Guksu
comfortsatisfyingkoreanvegetarianvegetarianchewycrispyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut potato into thin matchsticks. Cut zucchini into thin matchsticks or use a vegetable peeler for ribbons.

  2. Step 2

    Boil salted water in a large skillet or shallow pot. Add noodles and cook until just tender, about 4 minutes, then drain, reserving 1/4 cup pasta water.

  3. Step 3

    Return empty skillet to high heat. Add 2 tbsp oil. When it shimmers, add potato in a single layer and don't stir for 3 minutes until golden, then flip and crisp the other side, 2 minutes more.

  4. Step 4

    Push potato to the side. Add zucchini to the empty space, let it sear 2 minutes without stirring until lightly colored.

  5. Step 5

    Stir soy sauce, sesame oil, minced garlic, and reserved pasta water together. Pour over vegetables and noodles, toss gently to coat for 1 minute until glossy.

  6. Step 6

    Slide onto a plate. Top with scallions. Serve hot.

Tools you’ll need

  • large skillet or shallow 3-quart pot with lid
  • wooden spoon or tongs
  • vegetable peeler or sharp knife
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.