Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Meringue Nests with Berries & Cherry Compote

No-bake meringue nests (store-bought) topped with whipped cream, fresh berries, and warm cherry compote. A viral-worthy dessert that looks fancy but takes under 20 minutes.

Total time
18 min
Servings
4
Calories
385
Protein
3g
Crispy Meringue Nests with Berries & Cherry Compote
elegantindulgentfrenchvegetariancrispycreamyfluffydate-night

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pour cherry jam into a small saucepan over medium heat. Stir in lemon juice and warm for 2–3 minutes until pourable. Set aside.

  2. Step 2

    Pour heavy cream into a bowl. Add powdered sugar and vanilla. Whip with an electric mixer or whisk until soft peaks form, 2–3 minutes.

  3. Step 3

    Divide whipped cream evenly among the four meringue nests, dolloping gently into the center of each.

  4. Step 4

    Top each nest with a generous handful of fresh mixed berries, distributing them across the whipped cream.

  5. Step 5

    Drizzle warm cherry compote over the berries and whipped cream. Garnish with a mint leaf if desired.

  6. Step 6

    Serve immediately while meringue is crisp and compote is still warm.

Tools you’ll need

  • small saucepan
  • mixing bowl
  • electric mixer or whisk
  • dessert plates

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.