CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Mixed Fried Rice with Lemon & Cucumber

Fragrant Vietnamese-style fried rice loaded with shrimp, chicken, and egg, finished with a salty-savory crust and served with fresh cucumber and lime. Ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
512
Protein
28g
Crispy Mixed Fried Rice with Lemon & Cucumber
comfortsatisfyingvietnameseshrimpchickeneggscrispytender

Ingredients

  • 3 cups cooked jasmine rice (day-old or chilled)
  • 6 oz medium shrimp, peeled and deveined
  • 4 oz rotisserie chicken, shredded
  • 2 whole eggs
  • 2 tbsp soy sauce
  • 2 tbsp neutral cooking oil
  • ½ whole cucumber, sliced thin
  • ½ whole lemon (cut into wedges)

Instructions

  1. 1

    Heat oil in a large skillet over medium-high until shimmering, about 60 seconds.

  2. 2

    Add shrimp and cook without stirring for 90 seconds, then flip and cook 90 seconds more until pink.

  3. 3

    Push shrimp to the side. Crack eggs into the pan and scramble until just cooked, about 2 minutes.

  4. 4

    Add rice, breaking up clumps with a spoon, and stir constantly for 2 minutes until heated through.

  5. 5

    Stir in shredded chicken and soy sauce, then stop stirring and let the rice sit undisturbed for 90 seconds until a golden crust forms.

  6. 6

    Divide onto plates and serve immediately with cucumber slices and lemon wedges on the side.

Tools you’ll need

  • 12-inch skillet
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.