Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Mixed Fried Rice with Lemon & Cucumber

Fragrant Vietnamese-style fried rice loaded with shrimp, chicken, and egg, finished with a salty-savory crust and served with fresh cucumber and lime. Ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
512
Protein
28g
Crispy Mixed Fried Rice with Lemon & Cucumber
comfortsatisfyingvietnameseshrimpchickeneggscrispytender

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a large skillet over medium-high until shimmering, about 60 seconds.

  2. Step 2

    Add shrimp and cook without stirring for 90 seconds, then flip and cook 90 seconds more until pink.

  3. Step 3

    Push shrimp to the side. Crack eggs into the pan and scramble until just cooked, about 2 minutes.

  4. Step 4

    Add rice, breaking up clumps with a spoon, and stir constantly for 2 minutes until heated through.

  5. Step 5

    Stir in shredded chicken and soy sauce, then stop stirring and let the rice sit undisturbed for 90 seconds until a golden crust forms.

  6. Step 6

    Divide onto plates and serve immediately with cucumber slices and lemon wedges on the side.

Tools you’ll need

  • 12-inch skillet
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.