Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Mozzarella Pizza Toast Bites

Soft bread topped with pizza sauce, melty mozzarella, and pepperoni, broiled until the cheese bubbles and edges crisp. Ready in 8 minutes—the perfect snack that actually tastes like pizza.

Total time
8 min
Servings
2
Calories
286
Protein
14g
Crispy Mozzarella Pizza Toast Bites
casualquickitalianvegetariancheesecrispymeltygooey

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Arrange bread slices on a sheet pan or baking sheet in a single layer.

  2. Step 2

    Spread about 1 tbsp pizza sauce on each slice, leaving a 1/4-inch border.

  3. Step 3

    Top each slice with mozzarella, pepperoni (if using), and a pinch of minced garlic and oregano.

  4. Step 4

    Broil on the highest rack for 3–4 minutes, watching closely, until cheese melts and edges turn golden.

  5. Step 5

    Remove and let cool 1 minute before serving—the cheese will still be gooey.

Tools you’ll need

  • sheet pan or baking sheet
  • broiler

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.