Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Crispy Pan-Fried Chicken Dumplings

Store-bought wonton wrappers filled with seasoned ground chicken, pan-fried until golden and crispy. Serve with soy dipping sauce for an impressive weeknight dinner that tastes like takeout.

Total time
20 min
Servings
2
Calories
280
Protein
16g
20-Min Crispy Pan-Fried Chicken Dumplings
satisfyingchinesechickencrispytenderweeknightdumplingdinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix ground chicken with ginger, scallions, 1 tbsp soy sauce, and a pinch of salt until just combined.

  2. Step 2

    Place 1 tsp filling in center of each wonton wrapper. Wet edges with water, fold in half, then bring corners together and press to seal.

  3. Step 3

    Heat 1 tbsp oil in a 12-inch skillet over medium-high until it shimmers, about 90 seconds.

  4. Step 4

    Working in batches, add dumplings flat-side down and cook without moving for 3 minutes until bottoms are deep golden brown.

  5. Step 5

    Flip each dumpling, add a splash of water to the skillet, cover, and steam for 2 minutes until filling is cooked through.

  6. Step 6

    Whisk remaining 2 tbsp soy sauce with sesame oil and serve as dipping sauce alongside dumplings.

Tools you’ll need

  • 12-inch skillet
  • small bowl
  • measuring spoons
  • spoon for mixing

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.