Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Pan-Fried Wontons

Golden, crispy wontons with a savory pork and cabbage filling, finished in minutes with a sweet and tangy dipping sauce. Perfect as an appetizer or light dinner.

Total time
35 min
Servings
4
Calories
285
Protein
12g
Crispy Pan-Fried Wontons
casualsatisfyingchinesecrispytenderweeknightappetizerappetizer

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cook ground pork in a skillet over medium-high heat, breaking up with a spoon, until no pink remains, ~5 minutes.

  2. Step 2

    Add chopped cabbage and minced garlic to the pork. Cook, stirring, for 2 minutes until fragrant.

  3. Step 3

    Stir in 1 tbsp soy sauce and 1 tbsp sesame oil. Remove from heat and let cool 5 minutes.

  4. Step 4

    Whisk together remaining 2 tbsp soy sauce, rice vinegar, and honey in a small bowl for dipping sauce.

  5. Step 5

    Place 1 tbsp filling in the center of a wonton wrapper. Wet edges with water.

  6. Step 6

    Fold wrapper into a triangle, pressing edges to seal. Then bring two corners together and press to seal into a pouch.

  7. Step 7

    Repeat with remaining wrappers and filling until you have 24 wontons.

  8. Step 8

    Heat 2 tbsp oil in a large skillet over medium heat until it shimmers, ~1 minute.

  9. Step 9

    Working in batches, pan-fry wontons 2-3 minutes per side until golden brown and crispy. Don't crowd the pan.

  10. Step 10

    Transfer finished wontons to a paper towel-lined plate. Serve hot with dipping sauce.

Tools you’ll need

  • large skillet
  • small mixing bowl
  • whisk
  • spoon
  • paper towels
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.