Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Pan Potato Farl

Irish potato flatbread pan-fried until golden and crispy on the outside, tender inside. Serve hot with butter and a fried egg for a complete dinner.

Total time
20 min
Servings
2
Calories
340
Protein
5g
Crispy Pan Potato Farl
comfortirishvegetarianvegetariancrispytenderweeknightbread

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil potatoes whole and unpeeled in salted water until fork-tender, ~12 minutes.

  2. Step 2

    Drain and cool for 2 minutes, then peel while still warm.

  3. Step 3

    Mash potatoes roughly, then fold in flour, 1 tbsp butter, scallions, salt, and pepper until a dough forms.

  4. Step 4

    Divide dough in half, flatten each into a 0.5-inch-thick round on a work surface.

  5. Step 5

    Heat remaining 2 tbsp butter in a 10-inch skillet over medium-high until it sizzles.

  6. Step 6

    Pan-fry each farl until golden brown and crispy on both sides, ~3 minutes per side.

Tools you’ll need

  • large pot
  • colander
  • potato masher
  • 10-inch cast iron skillet or heavy-bottomed pan
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.