Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Poppy Seed Cheese Rolls

Hungarian-style savory pastry rolls with tart sour cream and fresh dill, baked until golden. A vegetarian weeknight dinner that tastes like it took hours.

Total time
18 min
Servings
4
Calories
348
Protein
12g
Crispy Poppy Seed Cheese Rolls
comfortsimplehungarianvegetariancheesecrispyflakytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Mix grated cheese, half the sour cream, dill, and a pinch each of salt and pepper in a bowl.

  2. Step 2

    Lay a phyllo sheet on a work surface. Brush lightly with melted butter, then spread 2–3 tbsp filling across one edge.

  3. Step 3

    Roll tightly from the filled edge, tucking in the sides. Place seam-side down on a parchment-lined sheet pan.

  4. Step 4

    Repeat with remaining phyllo sheets and filling. You'll have 8 rolls on the pan.

  5. Step 5

    Brush each roll with remaining butter and sprinkle poppy seeds over the top. Bake 12–14 minutes until golden brown.

  6. Step 6

    Serve warm with the reserved sour cream on the side for dipping.

Tools you’ll need

  • oven
  • parchment-lined sheet pan
  • mixing bowl
  • pastry brush
  • small knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.