Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Pork Belly with Leeks & Chili Oil

Hui guo rou reimagined for weeknights: crispy pork belly seared until it shatters, tossed with tender leeks and a punchy soy-chili glaze. Ready in 25 minutes.

Total time
25 min
Servings
2
Calories
520
Protein
28g
Crispy Pork Belly with Leeks & Chili Oil
satisfyingcasualchineseporkcrispytenderweeknightmain-dish

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut pork belly into 1-inch cubes. Slice leeks into 1/2-inch rounds, rinse well.

  2. Step 2

    Heat a large skillet over medium-high. Add pork skin-side down; render fat until skin crisps, ~8 minutes. Flip and sear meat side until golden, ~3 minutes.

  3. Step 3

    Remove pork to a plate. Pour off all but 1 tbsp fat. Add leeks; sauté until soft and slightly charred, ~4 minutes.

  4. Step 4

    Add garlic and ginger; cook until fragrant, ~30 seconds. Stir in soy sauce, vinegar, and chili oil.

  5. Step 5

    Return pork to skillet. Toss everything together for 1 minute until coated and heated through.

  6. Step 6

    Serve immediately over steamed white rice or with a simple side of blanched bok choy.

Tools you’ll need

  • 12-inch cast iron or heavy skillet
  • cutting board
  • chef's knife
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.