CookSnap is in beta — Get it free on TestFlight →
Back to recipes

15-Min Crispy Pork Carnitas with Rice & Beans

Rotisserie pork shredded and crisped in a skillet with cumin and lime, served over rice and beans with warm tortillas. Dinner on the table in 15 minutes.

Total time
15 min
Servings
2
Calories
520
Protein
38g
15-Min Crispy Pork Carnitas with Rice & Beans
satisfyingcasualmexicanporkcrispytenderweeknightmain-dish

Ingredients

  • 12 oz rotisserie pork, shredded
  • 1.5 cups cooked rice
  • 1 can (15 oz) canned black beans, drained
  • ¾ tsp cumin
  • 1 whole lime
  • 4 whole corn tortillas

Instructions

  1. 1

    Heat 1 tbsp oil in a large skillet over medium-high until shimmering, about 1 minute.

  2. 2

    Add shredded pork and cumin, stir to coat, then spread in a single layer.

  3. 3

    Cook without stirring for 4 minutes until edges crisp and brown. Stir once and cook 2 minutes more.

  4. 4

    Warm rice and beans in a small pot over low heat while pork finishes, about 3 minutes.

  5. 5

    Warm tortillas in a dry skillet for 30 seconds per side until pliable.

  6. 6

    Divide rice and beans between two plates, top with crispy pork, squeeze lime over, serve with warm tortillas.

Tools you’ll need

  • 12-inch skillet
  • small pot
  • spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.