Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Crispy Pork Carnitas with Rice & Beans

Rotisserie pork shredded and crisped in a skillet with cumin and lime, served over rice and beans with warm tortillas. Dinner on the table in 15 minutes.

Total time
15 min
Servings
2
Calories
520
Protein
38g
15-Min Crispy Pork Carnitas with Rice & Beans
satisfyingcasualmexicanporkcrispytenderweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp oil in a large skillet over medium-high until shimmering, about 1 minute.

  2. Step 2

    Add shredded pork and cumin, stir to coat, then spread in a single layer.

  3. Step 3

    Cook without stirring for 4 minutes until edges crisp and brown. Stir once and cook 2 minutes more.

  4. Step 4

    Warm rice and beans in a small pot over low heat while pork finishes, about 3 minutes.

  5. Step 5

    Warm tortillas in a dry skillet for 30 seconds per side until pliable.

  6. Step 6

    Divide rice and beans between two plates, top with crispy pork, squeeze lime over, serve with warm tortillas.

Tools you’ll need

  • 12-inch skillet
  • small pot
  • spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.