Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Pork Lomitos

Thin-sliced pork shoulder seared until edges crisp, tossed with sautéed peppers and onions, finished with lime and oregano. A fast, savory weeknight dinner that tastes like street food.

Total time
15 min
Servings
4
Calories
420
Protein
42g
Crispy Pork Lomitos
quickcasualmexicanporkcrispytenderweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  2. Step 2

    Work in two batches: sear pork slices 2–3 minutes per side until edges brown and crisp. Transfer to a plate.

  3. Step 3

    In the same skillet, sauté peppers and onions over medium-high, stirring occasionally, until soft and charred at edges, 4–5 minutes.

  4. Step 4

    Return pork to the skillet. Add oregano, lime juice, salt, and pepper. Toss to combine.

  5. Step 5

    Serve hot with warm tortillas, lime wedges, and fresh cilantro if desired.

Tools you’ll need

  • 12-inch skillet or larger
  • cutting board
  • sharp knife
  • tongs or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.