Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Pork & Rice Broken

Vietnamese com tam suon — crispy pork chops seared until golden, served over broken rice with a tangy lime-fish sauce drizzle. Comes together in under 20 minutes with minimal fuss.

Total time
20 min
Servings
2
Calories
520
Protein
32g
Crispy Pork & Rice Broken
satisfyingcasualvietnameseporkcrispytenderweeknightmain-dish

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    If using uncooked rice, boil in salted water until tender, ~15 min, then drain. If precooked, warm it gently.

  2. Step 2

    Pat pork chops dry with paper towels. Season both sides generously with salt and black pepper.

  3. Step 3

    Heat oil in a large skillet over medium-high heat until shimmering, ~90 seconds. Sear pork 3–4 minutes per side until golden brown and cooked through.

  4. Step 4

    Transfer pork to a cutting board. Stir the shallot into the hot skillet for 30 seconds until fragrant, then remove from heat.

  5. Step 5

    Whisk fish sauce and lime juice together in a small bowl. Spread rice on a plate, top with pork, and drizzle with fish sauce mixture.

  6. Step 6

    Scatter shallots, pâté (if using), and fresh herbs over the top. Serve immediately.

Tools you’ll need

  • pot (for cooking rice if not precooked)
  • 12-inch skillet
  • paper towels
  • cutting board
  • small mixing bowl
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.