Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Potato Gratin

Thinly sliced potatoes layered with Gruyère and cream, then crisped under the broiler in one skillet. A French bistro classic that feels fancy but takes less than 25 minutes.

Total time
25 min
Servings
4
Calories
520
Protein
18g
Crispy Potato Gratin
comfortelegantfrenchvegetariancheesecrispycreamytender

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat broiler to high. Slice potatoes 1/8-inch thick (use a mandoline if you have one); don't peel.

  2. Step 2

    Whisk cream, milk, mustard, nutmeg, salt, and pepper in a bowl until combined. Stir in minced shallot.

  3. Step 3

    Spread 1 tbsp butter in a 12-inch cast-iron or oven-safe skillet. Layer half the potatoes, overlapping slightly.

  4. Step 4

    Scatter half the Gruyère over potatoes. Layer remaining potatoes, then remaining cheese. Pour cream mixture over top.

  5. Step 5

    Tuck thyme sprigs into the layers. Slide skillet under broiler 8–10 minutes until edges are deep golden and bubbling.

  6. Step 6

    Remove from broiler and rest 2 minutes. Top surface should be crispy and cheese should pull away from edges.

Tools you’ll need

  • 12-inch cast-iron or oven-safe skillet
  • mandoline or sharp knife
  • medium bowl
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.