Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Potato Tacos with Cheese & Salsa

Shredded potato fried until golden-crisp, topped with melted cheddar and salsa, then stuffed into warm tortillas. A vegetarian weeknight dinner that takes 20 minutes and tastes like a taco stand.

Total time
20 min
Servings
2
Calories
380
Protein
9g
Crispy Potato Tacos with Cheese & Salsa
casualsatisfyingmexicanvegetariancrispymeltyweeknighttaco

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Peel and shred the potato into thin strands using a box grater or food processor.

  2. Step 2

    Squeeze the shredded potato hard over a bowl to remove excess moisture, then pat dry.

  3. Step 3

    Heat 2 tbsp oil in a large skillet over medium-high until shimmering, then add potato.

  4. Step 4

    Cook potato without stirring for 4 minutes until the bottom is golden, then toss and cook 3 minutes more until crispy throughout.

  5. Step 5

    Sprinkle cheddar over the potato and remove from heat, then warm tortillas in a dry skillet 30 seconds per side.

  6. Step 6

    Fill each tortilla with crispy potato and melted cheese, top with salsa, and serve immediately with lime wedges.

Tools you’ll need

  • box grater or food processor
  • large skillet, 12-inch
  • small skillet or griddle

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.