Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Rice Paper Rolls with Peanut Sauce

Vietnamese-style vegetable rolls wrapped in crispy rice paper, served with a warm peanut dipping sauce. Ready in 15 minutes with zero cooking required.

Total time
15 min
Servings
2
Calories
285
Protein
10g
Crispy Rice Paper Rolls with Peanut Sauce
freshlightvietnamesevegetarianveganvegetariancrispytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice cucumber lengthwise into 1/4-inch-thick batons. Tear lettuce into bite-size pieces. Tear herbs roughly.

  2. Step 2

    Whisk peanut butter with rice vinegar and 3 tbsp warm water until smooth and pourable. Add a pinch of salt.

  3. Step 3

    Dip one rice paper into room-temperature water for 5 seconds until pliable. Lay flat on a cutting board.

  4. Step 4

    Layer lettuce, cucumber batons, and herbs in a tight row near the bottom. Fold the sides in, then roll tightly.

  5. Step 5

    Repeat with remaining rice papers. Cut rolls in half on an angle if desired.

  6. Step 6

    Serve rolls with warm peanut sauce for dipping.

Tools you’ll need

  • cutting board
  • sharp knife
  • shallow dish or wide bowl for water
  • small bowl for sauce
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.