Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Roasted Corn Ribs

Corn sliced lengthwise into "ribs," roasted until caramelized and crispy, then brushed with a spiced butter and lime. A vegetable-forward side that eats like a main.

Total time
35 min
Servings
4
Calories
168
Protein
3g
Crispy Roasted Corn Ribs
casualsimplevegetariancrispytenderweeknightsummerside

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Line a large baking sheet with parchment paper.

  2. Step 2

    Stand each corn ear upright on a cutting board. Slice lengthwise into 3–4 pieces, following the natural seams.

  3. Step 3

    Arrange corn ribs cut-side up on the baking sheet. Drizzle lightly with olive oil, salt, and pepper.

  4. Step 4

    Roast for 15 minutes, shaking the pan halfway through, until edges are golden and caramelized.

  5. Step 5

    While corn cooks, melt butter in a small skillet over medium heat. Add garlic and chili powder, cook 60 seconds until fragrant.

  6. Step 6

    Remove from heat. Stir in lime juice, salt, and pepper.

  7. Step 7

    Remove corn from oven. Brush generously with the chili-lime butter on both sides.

  8. Step 8

    Return to oven for 3 more minutes until butter is absorbed and edges look crispy.

  9. Step 9

    Serve hot, with any remaining chili butter drizzled over the top.

Tools you’ll need

  • 9x13 baking sheet
  • parchment paper
  • sharp chef's knife
  • small skillet
  • cutting board
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.