Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Roti Canai with Curry Dip

Flaky, buttery roti fried until golden and served with a fragrant curry dip. A TikTok-friendly shortcut using store-bought roti sheets—no rolling or laminating required.

Total time
15 min
Servings
2
Calories
410
Protein
6g
Crispy Roti Canai with Curry Dip
casualquickmalaysianvegetarianvegetariancrispyflakysoft

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp butter in a skillet over medium-high until foaming, about 1 minute.

  2. Step 2

    Pan-fry roti sheets one at a time until edges curl and surface is golden, ~1 minute per side.

  3. Step 3

    Transfer roti to a plate; repeat with remaining sheets and 1 tbsp butter.

  4. Step 4

    In the same skillet, add onion and potato with a pinch of salt; sauté over medium-high for 4 minutes.

  5. Step 5

    Stir in curry powder, cook 1 minute until fragrant, then pour in coconut milk and a pinch of salt.

  6. Step 6

    Simmer 3 minutes, stirring occasionally, until sauce thickens slightly and potato begins to soften.

  7. Step 7

    Serve roti torn into pieces alongside the curry dip, topped with cilantro if desired.

Tools you’ll need

  • 12-inch non-stick or cast iron skillet
  • wooden spoon or spatula
  • small cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.