Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Crispy Rye Toast with Whipped Butter

Scandinavian-style dark rye bread toasted until the edges crackle, finished with cultured butter whipped with salt and fresh dill. A simple, satisfying open-faced meal that tastes like bakery-quality bread deserves.

Total time
15 min
Servings
2
Calories
240
Protein
5g
15-Min Crispy Rye Toast with Whipped Butter
simplewholesomescandinavianvegetariancrispytenderweeknightbread

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whip softened butter with dill and fleur de sel until pale and fluffy, about 2 minutes.

  2. Step 2

    Heat a large skillet over medium-high until very hot, about 90 seconds.

  3. Step 3

    Toast rye slices without oil until edges darken and surface crisps, 2–3 minutes per side.

  4. Step 4

    Spread whipped butter generously on each warm toast slice while still hot.

  5. Step 5

    Top with radish slices and a squeeze of lemon juice.

  6. Step 6

    Serve immediately while the toast is still warm.

Tools you’ll need

  • 12-inch skillet
  • small bowl
  • whisk or fork
  • butter knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.