CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Salt & Pepper Shrimp

Cornstarch-coated shrimp fried until golden and tossed with a fragrant salt-pepper-chili oil. Ready in 15 minutes and absolutely craveable.

Total time
15 min
Servings
2
Calories
285
Protein
28g
Crispy Salt & Pepper Shrimp
satisfyingquickchineseshrimpcrispytenderweeknightmain-dish

Ingredients

  • 1 lb large shrimp, peeled and deveined
  • ½ cup cornstarch
  • 4 cloves garlic, minced
  • 2 whole dried red chili, sliced (or chili flakes)
  • 2 stalks scallions, sliced into 1-inch pieces
  • 3 tbsp neutral oil for frying

Instructions

  1. 1

    Pat shrimp dry with paper towels. Toss with cornstarch, salt, and pepper until evenly coated.

  2. 2

    Heat oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  3. 3

    Add shrimp in a single layer and fry 2–3 minutes per side without stirring until golden and crispy.

  4. 4

    Push shrimp to the side. Add garlic and dried chili to the oil, stirring constantly for 30 seconds until fragrant.

  5. 5

    Toss shrimp with the garlic-chili oil and scallions. Taste and adjust salt and pepper.

  6. 6

    Serve immediately while crispy.

Tools you’ll need

  • large skillet (12-inch)
  • paper towels
  • shallow bowl or plate
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.