Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Salt & Pepper Shrimp

Cornstarch-coated shrimp fried until golden and tossed with a fragrant salt-pepper-chili oil. Ready in 15 minutes and absolutely craveable.

Total time
15 min
Servings
2
Calories
285
Protein
28g
Crispy Salt & Pepper Shrimp
satisfyingquickchineseshrimpcrispytenderweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat shrimp dry with paper towels. Toss with cornstarch, salt, and pepper until evenly coated.

  2. Step 2

    Heat oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  3. Step 3

    Add shrimp in a single layer and fry 2–3 minutes per side without stirring until golden and crispy.

  4. Step 4

    Push shrimp to the side. Add garlic and dried chili to the oil, stirring constantly for 30 seconds until fragrant.

  5. Step 5

    Toss shrimp with the garlic-chili oil and scallions. Taste and adjust salt and pepper.

  6. Step 6

    Serve immediately while crispy.

Tools you’ll need

  • large skillet (12-inch)
  • paper towels
  • shallow bowl or plate
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.