Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Seafood Banh Xeo (Vietnamese Sizzle Crepe)

Golden, lacy crepes stuffed with shrimp, squid, and crispy bean sprouts, served with lettuce and a tangy-sweet dipping sauce. Ready in under 25 minutes—the sizzle sound is half the fun.

Total time
25 min
Servings
2
Calories
420
Protein
24g
Crispy Seafood Banh Xeo (Vietnamese Sizzle Crepe)
casualsatisfyingvietnameseshrimpsquidcrispytendercrunchy

Ingredients

10 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk flour with 1 cup water, a pinch of salt, and 1 tbsp fish sauce until smooth. Let sit 5 minutes.

  2. Step 2

    Mix remaining fish sauce, sugar, and lime juice with 3 tbsp water for dipping sauce. Set aside.

  3. Step 3

    Heat 1 tbsp butter in a 10-inch nonstick skillet over medium-high until foamy. Add half the shrimp and squid, cook 90 seconds per side until opaque.

  4. Step 4

    Push seafood to the edge of the skillet. Pour in half the batter, immediately tilt and swirl to coat the pan evenly. Scatter half the bean sprouts over top.

  5. Step 5

    Cook until edges turn golden and crispy (edges should look lacy), about 3–4 minutes. Do not flip.

  6. Step 6

    Fold crepe in half and slide onto a plate. Repeat with remaining butter, seafood, batter, and sprouts. Serve with lettuce, herbs, and dipping sauce.

Tools you’ll need

  • 10-inch nonstick skillet
  • whisk
  • small bowl (for dipping sauce)
  • rubber spatula or wooden spoon
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.